LOGIN
Sale!
Semaglutide Peptide 5mg

Semaglutide

$90.00 – $175.00

Semaglutide Peptide 5mg is a synthetic analogue of Glucagon-Like Peptide-1 (GLP-1), a peptide involved in regulating glucose metabolism. It has been studied for its role in influencing insulin secretion and glucagon suppression in a glucose-dependent manner. Research has also explored its potential effects on appetite regulation, gastric emptying, and intestinal motility, as well as its broader implications for metabolic and cardiovascular pathways.

RESEARCH USE ONLY

These compounds are NOT intended for human consumption, clinical use, or veterinary applications. They are NOT FDA-approved. We are not affiliated with any pharmaceutical companies or their commercial medications. By placing an order, you certify these materials will be used exclusively for laboratory research only.

Chemical Formulation

Sequence

HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH₂

Molecular Formula

C187H291N45O59

Molecular Weight

4114 g/mol

PubChem CID

56843331

CAS Number

910463-68-2
sema-Test Report #48250 (2)-1

Research Studies

The King of Ozempic Is Scared as Hell

This article from Wired delves into Novo Nordisk’s challenges in balancing its legacy of producing life-saving insulin with the blockbuster success of semaglutide drugs like Ozempic and Wegovy. It highlights the company’s concerns over market dynamics, production pressures, and ethical dilemmas in the U.S. healthcare market.
Explore Research

Ozempic 3.0? This Drug Causes the Greatest Weight Loss - By Far

Published by the New York Post, this article discusses retatrutide, a new drug that has demonstrated superior weight loss results compared to semaglutide. In clinical studies, obese adults using retatrutide lost up to 22% of their starting weight after 11 months. The article highlights the potential of retatrutide as a more effective treatment for obesity, though it notes that further research is needed to confirm these findings.
Explore Research

You ask, we answer

fREQUENTLY ASKED qUESTIONS

At Peak Peptides, we only offer peptides that meet or exceed 98% purity, often surpassing 99%, as confirmed by independent third-party testing (including HPLC analysis). This strict verification process ensures our research peptides are of the highest quality, giving you complete confidence in every order.

At Peak Peptides, we dispatch all orders from our U.S. facility, with most customers receiving their shipments within 2-5 business days. Each package comes securely packed and includes tracking updates, no signature required.

Simply add Bacteriostatic Water (BAC Water) to the lyophilized peptide vial in your desired volume. For accurate dosing, we recommend using a peptide calculator (e.g., Peptide Calculator)(. https://peptide-calculators.com/) This helps ensure optimal concentration for your research needs.

Our peptides are shipped in lyophilized (freeze-dried) form, which ensures stability during transit. This powder form is highly stable at room temperature and resistant to temperature fluctuations that occur during shipping.

Research has shown no significant degradation or loss of purity when lyophilized peptides are exposed to room temperature during typical shipping timeframes. Each batch is verified for purity upon production, and our stability testing confirms maintenance of product integrity during standard shipping conditions.

For optimal long-term storage after receiving your order, we recommend storing the lyophilized peptides in a cool, dry place until reconstitution is needed.

For bulk inquiries and volume pricing, please email us at info@peakpeptides.com

Related Products

Retatrutide 5mg

Retatrutide

$115.00 – $275.00

Tirzepatide 10mg

Tirzepatide

$120.00

AOD9604 1.5mg

AOD9604

$25.00 – $80.00

Cagrilintide 10mg

Cagrilintide

$100.00

Navigation

popular

Get the Latest News

©2025 Peak Peptides. All rights reserved. Designed & Powered By Bizeebay SEO

LOGIN