Sale!

IGF-1 LR3

Original price was: $110.00.Current price is: $70.00.

IGF-1 LR3 (insulin-like growth factor-1 long arginine 3) is a synthetic variant of insulin-like growth factor-1. Its reduced binding to IGF-1 binding proteins allows it to remain active up to 120 times longer than standard IGF-1, resulting in an extended half-life and increased efficacy. IGF-1 LR3 has been investigated for its potential role in tissue repair and cellular growth.

RESEARCH USE ONLY

These compounds are NOT intended for human consumption, clinical use, or veterinary applications. They are NOT FDA-approved. We are not affiliated with any pharmaceutical companies or their commercial medications. By placing an order, you certify these materials will be used exclusively for laboratory research only.

Chemical Formulation

Sequence

MFPAMPLSSLFVNPPCCYRKSVETLRCGGELVNVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Molecular Formula

C990H1528N262O300S7

Molecular Weight

9117.5 g/mol

PubChem CID

CAS Number

143637-25-6
IGF 1 LR3 Test Report #53449-1

Research Studies

Top 10 Benefits of IGF-1 LR3 for Men

This article explores the regenerative and tissue-building properties of IGF-1 LR3, highlighting its potential benefits for muscle growth, recovery, anti-aging, and metabolic health. It emphasizes the importance of consulting with a healthcare professional before starting any peptide therapy to ensure safe and effective use.

IGF-1 LR3 Dosage Calculator and Chart | A-Z Guid

This comprehensive guide provides detailed information on the recommended dosages of IGF-1 LR3, including daily dosage ranges, administration frequency, study duration, and considerations for safe use. It also offers insights into monitoring glucose levels to prevent hypoglycemia during the course of administration.

You ask, we answer

fREQUENTLY ASKED qUESTIONS

At Peak Peptides, we only offer peptides that meet or exceed 98% purity, often surpassing 99%, as confirmed by independent third-party testing (including HPLC analysis). This strict verification process ensures our research peptides are of the highest quality, giving you complete confidence in every order.

At Peak Peptides, we dispatch all orders from our U.S. facility, with most customers receiving their shipments within 2-5 business days. Each package comes securely packed and includes tracking updates, no signature required.

Simply add Bacteriostatic Water (BAC Water) to the lyophilized peptide vial in your desired volume. For accurate dosing, we recommend using a peptide calculator (e.g., Peptide Calculator)(. https://peptide-calculators.com/) This helps ensure optimal concentration for your research needs.

Our peptides are shipped in lyophilized (freeze-dried) form, which ensures stability during transit. This powder form is highly stable at room temperature and resistant to temperature fluctuations that occur during shipping.

Research has shown no significant degradation or loss of purity when lyophilized peptides are exposed to room temperature during typical shipping timeframes. Each batch is verified for purity upon production, and our stability testing confirms maintenance of product integrity during standard shipping conditions.

For optimal long-term storage after receiving your order, we recommend storing the lyophilized peptides in a cool, dry place until reconstitution is needed.

For bulk inquiries and volume pricing, please email us at info@peakpeptides.com

Related Products