Cagrilintide

$100.00

Cagrilintide is a long-acting analogue of amylin, a naturally occurring peptide that is co-released with insulin. It has been studied for its role in metabolic processes and its potential effects on liver function, cardiovascular systems, and cellular mechanisms. Research has also explored its use in combination with other compounds for enhancing metabolic pathways, with ongoing investigations into its broader biological functions.

RESEARCH USE ONLY

These compounds are NOT intended for human consumption, clinical use, or veterinary applications. They are NOT FDA-approved. We are not affiliated with any pharmaceutical companies or their commercial medications. By placing an order, you certify these materials will be used exclusively for laboratory research only.

Chemical Formulation

Sequence

XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP

Molecular Formula

C₁₉₄H₃₁₂N₅₄O₅₉S₂

Molecular Weight

4409.01 g/mol

PubChem CID

171397054

CAS Number

1415456-99-3

Research Studies

Once-Weekly Cagrilintide for Weight Management in People with Overweight and Obesity

This study evaluates the efficacy and safety of once-weekly cagrilintide injections in individuals with overweight and obesity, demonstrating significant reductions in body weight and good tolerability.

Cagrilintide: A Long-Acting Amylin Analog for the Treatment of Obesity

This article discusses cagrilintide as a long-acting amylin analog, highlighting its potential in combination with GLP-1 agonists like semaglutide for sustained weight loss in individuals with obesity.

You ask, we answer

fREQUENTLY ASKED qUESTIONS

At Peak Peptides, we only offer peptides that meet or exceed 98% purity, often surpassing 99%, as confirmed by independent third-party testing (including HPLC analysis). This strict verification process ensures our research peptides are of the highest quality, giving you complete confidence in every order.

At Peak Peptides, we dispatch all orders from our U.S. facility, with most customers receiving their shipments within 2-5 business days. Each package comes securely packed and includes tracking updates, no signature required.

Simply add Bacteriostatic Water (BAC Water) to the lyophilized peptide vial in your desired volume. For accurate dosing, we recommend using a peptide calculator (e.g., Peptide Calculator)(. https://peptide-calculators.com/) This helps ensure optimal concentration for your research needs.

Our peptides are shipped in lyophilized (freeze-dried) form, which ensures stability during transit. This powder form is highly stable at room temperature and resistant to temperature fluctuations that occur during shipping.

Research has shown no significant degradation or loss of purity when lyophilized peptides are exposed to room temperature during typical shipping timeframes. Each batch is verified for purity upon production, and our stability testing confirms maintenance of product integrity during standard shipping conditions.

For optimal long-term storage after receiving your order, we recommend storing the lyophilized peptides in a cool, dry place until reconstitution is needed.

For bulk inquiries and volume pricing, please email us at info@peakpeptides.com

Related Products

$90.00$175.00

$115.00$275.00

$120.00

$25.00$80.00